PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo9G0014400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Nin-like
Protein Properties Length: 194aa    MW: 22084.7 Da    PI: 9.5898
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo9G0014400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK71.88.9e-23105151551
          RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                     ++++d+++yF+lpi +AA++L++c+T+LK+ CR++ ++RWPhRk+ s
  Spipo9G0014400 105 LTFKDIAQYFHLPIIEAAQKLQICTTALKKVCRKFHLNRWPHRKVLS 151
                     89******************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.72292172IPR003035RWP-RK domain
PfamPF020425.1E-21105150IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MEYPDDYLLP GGTMKLQASP SVPVQGDHLI KNFHAAEGLP KRLSRNPQKL DESMAWDCYP  60
HLRGQSCPDV WGDGEDHKKP IAIKETRLQI RKAGIAGQRQ RTGLLTFKDI AQYFHLPIIE  120
AAQKLQICTT ALKKVCRKFH LNRWPHRKVL SSAKKIQNLK ACLKDQDYDM TMRTLLLLQI  180
ENQELENIYG APV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.16e-12RWP-RK domain-containing protein